| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | DDX27 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The DDX27 Antibody from Novus Biologicals is a rabbit polyclonal antibody to DDX27. This antibody reacts with human. The DDX27 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human DDX27 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: EDKEAKSGKLEKEKEAKEGSEPKEQEDLQENDEEGSEDEASETDYSSADENILTKADTLKVKDRKKKKKKGQEAGVFFEDASQYDENLSFQ |
|---|
| Other Names | DEAD (Asp-Glu-Ala-Asp) box polypeptide 27, DEAD box protein 27, DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 27, dJ686N3.1, DKFZp667N057, DRS1, EC 3.6.1, EC 3.6.4.13, FLJ12917, FLJ20596, FLJ22238, MGC1018, MGC163147, PP3241, probable ATP-dependent RNA helicase DDX27, RHLP, RNA helicase-like protein, Rrp3p |
|---|
| Gene, Accession # | DDX27, Gene ID: 55661 |
|---|
| Catalog # | NBP1-91825 |
|---|
| Price | |
|---|
| Order / More Info | DDX27 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|