| Edit |   |
| Antigenic Specificity | GPR19 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human (antigen sequence identity: mouse 60%, rat 60%) |
| Isotype | n/a |
| Format | antigen affinity purified |
| Size | 100 µl |
| Concentration | n/a |
| Applications | IHC |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit anti-human GPR19 polyclonal antibody. |
| Immunogen | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: RMDNSKPHLIIPTLLVPLQNRSCTETATPLPSQYLMELSEEHSWMSNQTD |
| Other Names | G protein-coupled receptor 19 |
| Gene, Accession # | Gene ID: 2842, UniProt: Q15760, ENSG00000183150 |
| Catalog # | HPA013955 |
| Price | |
| Order / More Info | GPR19 Antibody from ATLAS ANTIBODIES AB |
| Product Specific References | n/a |