| Edit |   |
| Antigenic Specificity | Syntaxin 4 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The Syntaxin 4 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Syntaxin 4. This antibody reacts with human. The Syntaxin 4 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to STX4 (syntaxin 4) The peptide sequence was selected from the C terminal of STX4. Peptide sequence VEMQGEMINRIEKNILSSADYVERGQEHVKTALENQKKARKKKVLIAICV. |
| Other Names | Renal carcinoma antigen NY-REN-31, STX4Ap35-2, syntaxin 4, syntaxin 4A (placental), syntaxin-4 |
| Gene, Accession # | STX4, Gene ID: 6810, Accession: Q12846, SwissProt: Q12846 |
| Catalog # | NBP1-69179-20ul |
| Price | |
| Order / More Info | Syntaxin 4 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |