| Edit |   |
|---|
| Antigenic Specificity | Syntaxin 4 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Syntaxin 4 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Syntaxin 4. This antibody reacts with human. The Syntaxin 4 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to STX4 (syntaxin 4) The peptide sequence was selected from the C terminal of STX4. Peptide sequence VEMQGEMINRIEKNILSSADYVERGQEHVKTALENQKKARKKKVLIAICV. |
|---|
| Other Names | Renal carcinoma antigen NY-REN-31, STX4Ap35-2, syntaxin 4, syntaxin 4A (placental), syntaxin-4 |
|---|
| Gene, Accession # | STX4, Gene ID: 6810, Accession: Q12846, SwissProt: Q12846 |
|---|
| Catalog # | NBP1-69179 |
|---|
| Price | |
|---|
| Order / More Info | Syntaxin 4 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|