| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | NK3R/TACR3/Neurokinin B Receptor |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The NK3R/TACR3/Neurokinin B Receptor Antibody from Novus Biologicals is a rabbit polyclonal antibody to NK3R/TACR3/Neurokinin B Receptor. This antibody reacts with human. The NK3R/TACR3/Neurokinin B Receptor Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human NK3R/TACR3/Neurokinin B Receptor antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: MATLPAAETWIDGGGGVGADAVNLTASLAAGAATGAVETGWLQLLDQAGNLSSSPSALGLPVASPAPSQPWANLTNQFVQPSWRIALWS |
|---|
| Other Names | Neurokinin B receptor, neurokinin beta receptor, neuromedin-K receptor, NK-3 receptor, NK-3R, NK3RMGC148061, NKR, TAC3R, TAC3RL, tachykinin receptor 3MGC148060 |
|---|
| Gene, Accession # | TACR3, Gene ID: 6870, Accession: P29371, SwissProt: P29371 |
|---|
| Catalog # | NBP1-82561 |
|---|
| Price | |
|---|
| Order / More Info | NK3R/TACR3/Neurokinin B Receptor Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|