| 产品详情 |
| Edit |   |
| Antigenic Specificity | SDNSF/MCFD2 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The SDNSF/MCFD2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SDNSF/MCFD2. This antibody reacts with human. The SDNSF/MCFD2 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human SDNSF/MCFD2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: ASFSQPGSMGLDKNTVHDQEHIMEHLEGVINKPEAEMSPQELQLHYFKMHDYDGNNLLDGLELSTAITHVHKEEGSEQAPLMSEDELIN |
| Other Names | DKFZp686G21263, F5F8D2, LMAN1IP, multiple coagulation factor deficiency 2, multiple coagulation factor deficiency protein 2, neural stem cell derived neuronal survival protein, Neural stem cell-derived neuronal survival protein, SDNSFF5F8D |
| Gene, Accession # | MCFD2, Gene ID: 90411, Accession: Q8NI22, SwissProt: Q8NI22 |
| Catalog # | NBP2-37873 |
| Price | |
| Order / More Info | SDNSF/MCFD2 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|