| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | HLA-DQB1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | unconjugated |
|---|
| Size | 100ug (sample available) |
|---|
| Concentration | 0.5-1mg/ml, actual concentration varies by lot. |
|---|
| Applications | WB |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit IgG polyclonal Picoband™ antibody for HLA-DQB1 detection. Tested with WB in Human. No cross reactivity with other proteins. Major histocompatibility complex, class II, DQ beta 1, also known as HLA-DQB1, is a human gene and also denotes the genetic locus that contains this gene. HLA-DQB1 belongs to the HLA class II beta chain paralogs. This class II molecule is a heterodimer consisting of an alpha (DQA) and a beta chain (DQB), both anchored in the membrane. It plays a central role in the immune system by presenting peptides derived from extracellular proteins. Class II molecules are expressed in antigen presenting cells (APC: B lymphocytes, dendritic cells, macrophages). The beta chain is approximately 26-28 kDa and it contains six exons. Exon 1 encodes the leader peptide, exons 2 and 3 encode the two extracellular domains, exon 4 encodes the transmembrane domain and exon 5 encodes the cytoplasmic tail. Within the DQ molecule both the alpha chain and the beta chain contain the polymorphisms specifying the peptide binding specificities, resulting in up to four different molecules. Typing for these polymorphisms is routinely done for bone marrow transplantation. Alternative splicing results in multiple transcript variants. |
|---|
| Immunogen | A synthetic peptide corresponding to a sequence of human HLA-DQB1 (DAEYWNSQKEVLERTRAELDTVCRHNYQLELRTTLQRR). |
|---|
| Other Names | HLA class II histocompatibility antigen, DQ beta 1 chain; MHC class II antigen DQB1; HLA-DQB1; HLA-DQB |
|---|
| Gene, Accession # | HLA-DQB1, UniProt: P01920 |
|---|
| Catalog # | A00106-1 |
|---|
| Price | |
|---|
| Order / More Info | HLA-DQB1 Antibody from BOSTER BIO |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|