| Edit |   |
|---|
| Antigenic Specificity | Mercaptopyruvate Sulfurtransferase (MPST) (Middle Region) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | MPST transfer of a sulfur ion to cyanide or to other thiol compounds. MPST also has weak rhodanese activity. MPST may have a role in cyanide degradation or in thiosulfate biosynthesis. |
|---|
| Immunogen | MPST antibody was raised using the middle region of MPST corresponding to a region with amino acids DPAFIKTYEDIKENLESRRFQVVDSRATGRFRGTEPEPRDGIEPGHIPGT |
|---|
| Other Names | mst|tst|tst2|fa96h11|mpst|wu:fa96h11|MST|TST2|Mst |
|---|
| Gene, Accession # | Gene ID: 4357 |
|---|
| Catalog # | ABIN631061 |
|---|
| Price | |
|---|
| Order / More Info | Mercaptopyruvate Sulfurtransferase (MPST) (Middle Region) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|