| Edit |   |
| Antigenic Specificity | Solute Carrier Family 6 (Neurotransmitter Transporter, GABA), Member 1 (SLC6A1) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 µg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | SLC6A1 terminates the action of GABA by its high affinity sodium-dependent reuptake into presynaptic terminals. This protein is the target of psychomotor stimulants such as amphetamines or cocaine. |
| Immunogen | SLC6 A1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LIILFFRGVTLPGAKEGILFYITPNFRKLSDSEVWLDAATQIFFSYGLGL |
| Other Names | A730043E01|GABATHG|GABATR|GAT-1|Gabt|Gabt1|Gat1|XT-1|Xtrp1|si:ch211-280e18.1|si:dkey-164m14.1|slc6a1|GAT1 |
| Gene, Accession # | Gene ID: 6529 |
| Catalog # | ABIN635334 |
| Price | |
| Order / More Info | Solute Carrier Family 6 (Neurotransmitter Transporter, GABA), Member 1 (SLC6A1) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |