| Edit |   |
| Antigenic Specificity | Solute Carrier Family 22 (Organic Anion Transporter), Member 8 (SLC22A8) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 µg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | SLC22A8 is involved in the sodium-independent transport and excretion of organic anions, some of which are potentially toxic. SLC22A8 is an integral membrane protein and appears to be localized to the basolateral membrane of the kidney. |
| Immunogen | SLC22 A8 antibody was raised using a synthetic peptide corresponding to a region with amino acids PETLNQPLPETIEDLENWSLRAKKPKQEPEVEKASQRIPLQPHGPGLGSS |
| Other Names | OAT3|OCT3|Oat3|Roct|EMT|EMTH|Oct3|Orct3|Slca22a3 |
| Gene, Accession # | Gene ID: 9376 |
| Catalog # | ABIN635617 |
| Price | |
| Order / More Info | Solute Carrier Family 22 (Organic Anion Transporter), Member 8 (SLC22A8) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |