| Edit |   |
|---|
| Antigenic Specificity | Solute Carrier Family 22 (Organic Anion Transporter), Member 13 (SLC22A13) (N-Term) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | SLC22A13 is a member of the organic-cation transporter family. SLC22A13 is a transmembrane protein involved in the transport of small molecules. This protein can function to mediate urate uptake and is a high affinity nicotinate exchanger in the kidneys and the intestine. |
|---|
| Immunogen | SLC22 A13 antibody was raised using the N terminal of SLC22 13 corresponding to a region with amino acids FFAHVFMVLDEPHHCAVAWVKNHTFNLSAAEQLVLSVPLDTAGHPEPCLM |
|---|
| Other Names | OAT10|OCTL1|OCTL3|ORCTL-3|ORCTL3|AI648912 |
|---|
| Gene, Accession # | Gene ID: 9390,102570,316062 |
|---|
| Catalog # | ABIN635939 |
|---|
| Price | |
|---|
| Order / More Info | Solute Carrier Family 22 (Organic Anion Transporter), Member 13 (SLC22A13) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|