| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Bcl-10 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Bcl-10 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Bcl-10. This antibody reacts with human. The Bcl-10 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human Bcl-10 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: MEPTAPSLTEEDLTEVKKDALENLRVYLCEKIIAERHFDHLRAKKILSREDTEEISCRT |
|---|
| Other Names | B-cell CLL/lymphoma 10CIPERCLAPB-cell lymphoma/leukemia 10, Bcl-10, CARD-containing apoptotic signaling protein, CARD-containing molecule enhancing NF-kappa-B, CARD-containing proapoptotic protein, CARD-like apoptotic protein, CARMEN, caspase-recruiting domain-containing protein, cCARMEN, c-E10bcl-10, CED-3/ICH-1 prodomain homologous E10-like regulator, Cellular homolog of vCARMEN, cellular-E10, hCLAP, Mammalian CARD-containing adapter molecule E10, mE10CARD containing molecule enhancing NF-kB |
|---|
| Gene, Accession # | BCL10, Gene ID: 8915 |
|---|
| Catalog # | NBP1-85697 |
|---|
| Price | |
|---|
| Order / More Info | Bcl-10 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|