| Edit |   |
|---|
| Antigenic Specificity | Nucleophosmin/nucleoplasmin 2 (NPM2) (N-Term) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | NPM2 belongs to the nucleoplasmin family. It probably involved in sperm DNA decondensation during fertilization. |
|---|
| Immunogen | NPM2 antibody was raised using the N terminal of NPM2 corresponding to a region with amino acids LEGKQSCRLLLHTICLGEKAKEEMHRVEILPPANQEDKKMQPVTIASLQA |
|---|
| Other Names | n/a |
|---|
| Gene, Accession # | Gene ID: 10361 |
|---|
| Catalog # | ABIN634104 |
|---|
| Price | |
|---|
| Order / More Info | Nucleophosmin/nucleoplasmin 2 (NPM2) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|