| Edit |   |
|---|
| Antigenic Specificity | ATPase Inhibitory Factor 1 (ATPIF1) (N-Term) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | This gene encodes a mitochondrial ATPase inhibitor. Alternative splicing occurs at this locus and three transcript variants encoding distinct isoforms have been identified. |
|---|
| Immunogen | ATPIF1 antibody was raised using the N terminal of ATPIF1 corresponding to a region with amino acids GSIREAGGAFGKREQAEEERYFRAQSREQLAALKKHHEEEIVHHKKEIER |
|---|
| Other Names | ATPIF1|IF(1)|IF1|atpi|atpip|ATPI|ATPIP|IP|Atpi|If1|IF1PA|IF(1) A|IF1 A|atpif1|zgc:162207 |
|---|
| Gene, Accession # | Gene ID: 93974 |
|---|
| Catalog # | ABIN633876 |
|---|
| Price | |
|---|
| Order / More Info | ATPase Inhibitory Factor 1 (ATPIF1) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|