| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | ADAM12 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ADAM12 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ADAM12. This antibody reacts with human. The ADAM12 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human ADAM12 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: VTLAHELGHNFGMNHDTLDRGCSCQMAVEKGGCIMNASTGYPFPMVFSSCSRKDLETSLEKGMGVCLFNLPEVRESFGGQKCGNRFVEEG |
|---|
| Other Names | a disintegrin and metalloproteinase domain 12 (meltrin alpha), ADAM 12, ADAM metallopeptidase domain 12, disintegrin and metalloproteinase domain-containing protein 12, EC 3.4.24, EC 3.4.24.58, MCMP, MCMPMltna, Meltrin-alpha, MLTNA, MLTNEC 3.4.24.- |
|---|
| Gene, Accession # | ADAM12, Gene ID: 8038, Accession: O43184, SwissProt: O43184 |
|---|
| Catalog # | NBP2-33940 |
|---|
| Price | |
|---|
| Order / More Info | ADAM12 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|