| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | ADAM12 |
|---|
| Clone | 1G3 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG3 kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA. Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ADAM12 Antibody (1G3) from Novus Biologicals is a mouse monoclonal antibody to ADAM12. This antibody reacts with human. The ADAM12 Antibody (1G3) has been validated for the following applications: Western Blot, ELISA. |
|---|
| Immunogen | ADAM12 (NP_003465, 208 a.a. - 304 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. ETLKATKYVELVIVADNREFQRQGKDLEKVKQRLIEIANHVDKFYRPLNIRIVLVGVEVWNDMDKCSVSQDPFTSLHEFLDWRKMKLLPRKSHDNAQ |
|---|
| Other Names | a disintegrin and metalloproteinase domain 12 (meltrin alpha), ADAM 12, ADAM metallopeptidase domain 12, disintegrin and metalloproteinase domain-containing protein 12, EC 3.4.24, EC 3.4.24.58, MCMP, MCMPMltna, Meltrin-alpha, MLTNA, MLTNEC 3.4.24.- |
|---|
| Gene, Accession # | ADAM12, Gene ID: 8038, Accession: NP_003465, SwissProt: NP_003465 |
|---|
| Catalog # | H00008038-M01 |
|---|
| Price | |
|---|
| Order / More Info | ADAM12 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 18365756 |
|---|
| 产品资料 |
|
|