| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | ADAM19 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ADAM19 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ADAM19. This antibody reacts with human, mouse. The ADAM19 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence. |
|---|
| Immunogen | Synthetic peptides corresponding to ADAM19(ADAM metallopeptidase domain 19 (meltrin beta)) The peptide sequence was selected from the N terminal of ADAM19 (NP_075525). Peptide sequence VADYLEFQKNRRDQDATKHKLIEIANYVDKFYRSLNIRIALVGLEVWTHG. |
|---|
| Other Names | a disintegrin and metalloproteinase domain 19 (meltrin beta), ADAM 19, ADAM metallopeptidase domain 19, disintegrin and metalloproteinase domain-containing protein 19, EC 3.4.24, EC 3.4.24.-, MADDAM, Meltrin-beta, Metalloprotease and disintegrin dendritic antigen marker, MLTNBmeltrin beta |
|---|
| Gene, Accession # | ADAM19, Gene ID: 8728, Accession: Q9H013, SwissProt: Q9H013 |
|---|
| Catalog # | NBP1-69364 |
|---|
| Price | |
|---|
| Order / More Info | ADAM19 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 16618722, 17112471, 22930161 |
|---|
| 产品资料 |
|
|