| Edit |   |
|---|
| Antigenic Specificity | BRCA1 Associated Protein (BRAP) (Middle Region) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The protein encoded by this gene was identified by its ability to bind to the nuclear localization signal of BRCA1 and other proteins. It is a cytoplasmic protein which may regulate nuclear targeting by retaining proteins with a nuclear localization signal in the cytoplasm. |
|---|
| Immunogen | BRAP antibody was raised using the middle region of BRAP corresponding to a region with amino acids YLETQQKINHLPAETRQEIQEGQINIAMASASSPASSGGSGKLPSRKGRS |
|---|
| Other Names | imp|MGC68778|zgc:92894|BRAP|BRAP2|IMP|RNF52|3010002G07Rik |
|---|
| Gene, Accession # | Gene ID: 8315 |
|---|
| Catalog # | ABIN631144 |
|---|
| Price | |
|---|
| Order / More Info | BRCA1 Associated Protein (BRAP) (Middle Region) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|