| Edit |   |
| Antigenic Specificity | Phosphoglucomutase 1 (PGM1) (Middle Region) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse, rat |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 µg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | PGM1 is an isozyme of phosphoglucomutase (PGM) and belongs to the phosphohexose mutase family. There are several PGM isozymes, which are encoded by different genes and catalyze the transfer of phosphate between the 1 and 6 positions of glucose. |
| Immunogen | PGM1 antibody was raised using the middle region of PGM1 corresponding to a region with amino acids ATIRLYIDSYEKDVAKINQDPQVMLAPLISIALKVSQLQERTGRTAPTVI |
| Other Names | PGM1|ARABIDOPSIS THALIANA PHOSPHOGLUCOMUTASE|ATPGMP|MIO24.4|MIO24_4|PHOSPHOGLUCOMUTASE|STARCH-FREE 1|STF1|phosphoglucomutase|PSPTO3035|CMS0426|CDG1T|GSD14|3230402E02Rik|Pgm-1|Pgm2|zgc:63718|pgm2|phosphoglucomutase-1|PGM |
| Gene, Accession # | Gene ID: 5236,66681,24645 |
| Catalog # | ABIN632042 |
| Price | |
| Order / More Info | Phosphoglucomutase 1 (PGM1) (Middle Region) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |