| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | DCXR |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The DCXR Antibody from Novus Biologicals is a rabbit polyclonal antibody to DCXR. This antibody reacts with human. The DCXR Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human DCXR antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: IRVNAVNPTVVMTSMGQATWSDPHKAKTMLNRIPLGKFAEVEHVVNAILFLLSDRSGMTTGSTLPVEG |
|---|
| Other Names | Carbonyl reductase II, DCR, dicarbonyl/L-xylulose reductaseP34H, EC 1.1.1, EC 1.1.1.10, HCR2, HCRII, human carbonyl reductase 2, KIDCR, Kidney dicarbonyl reductase, L-xylulose reductase, SDR20C1, short chain dehydrogenase/reductase family 20C, member 1, Sperm surface protein P34H, XR |
|---|
| Gene, Accession # | DCXR, Gene ID: 51181 |
|---|
| Catalog # | NBP1-85280 |
|---|
| Price | |
|---|
| Order / More Info | DCXR Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|