| Edit |   |
|---|
| Antigenic Specificity | Interferon-Induced Protein 44 (IFI44) (Middle Region) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | This protein aggregates to form microtubular structures. |
|---|
| Immunogen | IFI44 antibody was raised using the middle region of IFI44 corresponding to a region with amino acids LIEIERCEPVRSKLEEVQRKLGFALSDISVVSNYSSEWELDPVKDVLILS |
|---|
| Other Names | MATP44|MTAP44|TLDC5|p44|A430056A10Rik|AW261460 |
|---|
| Gene, Accession # | Gene ID: 10561 |
|---|
| Catalog # | ABIN632234 |
|---|
| Price | |
|---|
| Order / More Info | Interferon-Induced Protein 44 (IFI44) (Middle Region) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|