| Edit |   |
|---|
| Antigenic Specificity | Interferon-Induced Protein 35 (IFI35) (N-Term) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | IFI35 has been shown to interact with NMI and BATF. |
|---|
| Immunogen | IFI35 antibody was raised using the N terminal of IFI35 corresponding to a region with amino acids MSAPLDAALHALQEEQARLKMRLWDLQQLRKELGDSPKDKVPFSVPKIPL |
|---|
| Other Names | IFI35|IFP35|2010008K16Rik|AW986054|ifi-35 |
|---|
| Gene, Accession # | Gene ID: 3430 |
|---|
| Catalog # | ABIN630552 |
|---|
| Price | |
|---|
| Order / More Info | Interferon-Induced Protein 35 (IFI35) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|