| Edit |   |
|---|
| Antigenic Specificity | Interferon-Induced Protein 44-Like (IFI44L) (N-Term) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | purified |
|---|
| Size | 100 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB),Immunohistochemistry (IHC) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The function of this gene remains unknown. |
|---|
| Immunogen | IFI44 L antibody was raised using the N terminal of IFI44 corresponding to a region with amino acids MEVTTRLTWNDENHLRKLLGNVSLSLLYKSSVHGGSIEDMVERCSRQGCT |
|---|
| Other Names | H28|IFI44L|H-28|H28-1|NS1178|C1orf29 |
|---|
| Gene, Accession # | Gene ID: 10964 |
|---|
| Catalog # | ABIN629863 |
|---|
| Price | |
|---|
| Order / More Info | Interferon-Induced Protein 44-Like (IFI44L) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|