| Edit |   |
|---|
| Antigenic Specificity | Interferon-Induced Protein with Tetratricopeptide Repeats 3 (IFIT3) (N-Term) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB),Immunohistochemistry (IHC) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | IFIT3 is involved in protein binding. |
|---|
| Immunogen | IFIT3 antibody was raised using the N terminal of IFIT3 corresponding to a region with amino acids ATMYNLLAYIKHLDGNNEAALECLRQAEELIQQEHADQAEIRSLVTWGNY |
|---|
| Other Names | DKFZp469G2233|CIG-49|GARG-49|IFI60|IFIT4|IRG2|ISG60|P60|RIG-G|Ifi49|P49|IFIT-3 |
|---|
| Gene, Accession # | Gene ID: 3437 |
|---|
| Catalog # | ABIN632163 |
|---|
| Price | |
|---|
| Order / More Info | Interferon-Induced Protein with Tetratricopeptide Repeats 3 (IFIT3) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|