| Edit |   |
|---|
| Antigenic Specificity | COX10 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human (antigen sequence identity: mouse 65%, rat 59%) |
|---|
| Isotype | n/a |
|---|
| Format | antigen affinity purified |
|---|
| Size | 100 µl |
|---|
| Concentration | n/a |
|---|
| Applications | IHC, WB. Recombinant expression validation in WB using target protein overexpression. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | Rabbit anti-human COX10 polyclonal antibody. |
|---|
| Immunogen | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: PNEKELIELEPDSVIEDSIDVGKETKEEKRWKEMKLQVYDLPGILARLS |
|---|
| Other Names | cytochrome c oxidase assembly homolog 10 (yeast) |
|---|
| Gene, Accession # | Gene ID: 1352, UniProt: Q12887, ENSG00000006695 |
|---|
| Catalog # | HPA032005 |
|---|
| Price | |
|---|
| Order / More Info | COX10 Antibody from ATLAS ANTIBODIES AB |
|---|
| Product Specific References | n/a |
|---|