| Edit |   |
|---|
| Antigenic Specificity | Kelch Domain Containing 8A (KLHDC8A) (C-Term) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | purified |
|---|
| Size | 100 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The function of KLHDC8A protein is not widely studied, and is yet to be elucidated fully. |
|---|
| Immunogen | KLHDC8 A antibody was raised using the C terminal of KLHDC8 corresponding to a region with amino acids PGKNKWEILPAMPTPRCACSSIVVKNCLLAVGGVNQGLSDAVEALCVSDS |
|---|
| Other Names | KLHDC8A|KLHL18|MGC145950|A630065K24Rik|RGD1305132 |
|---|
| Gene, Accession # | Gene ID: 55220 |
|---|
| Catalog # | ABIN629982 |
|---|
| Price | |
|---|
| Order / More Info | Kelch Domain Containing 8A (KLHDC8A) (C-Term) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|