| Edit |   |
| Antigenic Specificity | Kelch Domain Containing 8B (KLHDC8B) (N-Term) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse, rat |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50 µg |
| Concentration | n/a |
| Applications | Western Blotting (WB) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | KLHDC8B contains 8 Kelch repeats. The exact function of KLHDC8B remains unknown. |
| Immunogen | KLHDC8 B antibody was raised using the N terminal of KLHDC8 corresponding to a region with amino acids MSAGGGRAFAWQVFPPMPTCRVYGTVAHQDGHLLVLGGCGRAGLPLDTAE |
| Other Names | DKFZp468J2023|4931406O17Rik |
| Gene, Accession # | Gene ID: 200942,78267,306589 |
| Catalog # | ABIN632243 |
| Price | |
| Order / More Info | Kelch Domain Containing 8B (KLHDC8B) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |