| Edit |   |
|---|
| Antigenic Specificity | Kelch Domain Containing 9 (KLHDC9) (Middle Region) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The function of KLHDC9 protein is not widely studied, and is yet to be elucidated fully. |
|---|
| Immunogen | KLHDC9 antibody was raised using the middle region of KLHDC9 corresponding to a region with amino acids AEPEVAGHWSHGKIKEEPPVAPHLMEQLARLVSSGQGSQKGPHGLRHHSC |
|---|
| Other Names | KARCA1|1190002J23Rik|AA087357|ESTM31 |
|---|
| Gene, Accession # | Gene ID: 126823 |
|---|
| Catalog # | ABIN632579 |
|---|
| Price | |
|---|
| Order / More Info | Kelch Domain Containing 9 (KLHDC9) (Middle Region) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|