| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | PLOD1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The PLOD1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to PLOD1. This antibody reacts with human. The PLOD1 Antibody has been validated for the following applications: Western Blot. Specificity of human PLOD1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: YISNIYLIKGSALRGELQSSDLFHHSKLDPDMAFCANIRQQDVFMFLTNRHTLGHLLSLDSYRTTHLHNDLWEVFSN |
|---|
| Other Names | 2-oxoglutarate 5-dioxygenase 1, EC 1.14.11.4, Ehlers-Danlos syndrome type VI), FLJ42041, LH1, LLH, lysine hydroxylase, Lysyl hydroxylase 1, PLODLH, procollagen-lysine, procollagen-lysine 1, 2-oxoglutarate 5-dioxygenase (lysine hydroxylase, procollagen-lysine 1, 2-oxoglutarate 5-dioxygenase 1, procollagen-lysine, 2-oxoglutarate 5-dioxygenase |
|---|
| Gene, Accession # | PLOD1, Gene ID: 5351, Accession: Q02809, SwissProt: Q02809 |
|---|
| Catalog # | NBP2-31885 |
|---|
| Price | |
|---|
| Order / More Info | PLOD1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|