| Edit |   |
|---|
| Antigenic Specificity | ARF4 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ARF4 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ARF4. This antibody reacts with human, mouse. The ARF4 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptide directed towards the N terminal of human Arf4The immunogen for this antibody is Arf4. Peptide sequence VGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNICFTVWDVGGQD. |
|---|
| Other Names | ADP-ribosylation factor 4, ARF2ADP-ribosylation factor 2 |
|---|
| Gene, Accession # | ARF4, Gene ID: 378, Accession: NP_031505 |
|---|
| Catalog # | NBP1-79614-20ul |
|---|
| Price | |
|---|
| Order / More Info | ARF4 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|