| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | ITPKB |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Use in Western blot reported in scientific literature (PMID 26642205) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ITPKB Antibody from Novus Biologicals is a rabbit polyclonal antibody to ITPKB. This antibody reacts with human. The ITPKB Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human ITPKB antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: PDKPFLRKACSPSNIPAVIITDMGTQEDGALEETQGSPRGNLPLRKLSSSSASSTGFSSSYEDSEEDISSDPE |
|---|
| Other Names | EC 2.7.1.127, inositol 14,5-trisphosphate 3-kinase BIP3K, inositol-trisphosphate 3-kinase B, InsP 3-kinase B, IP3 3-kinase B, IP3-3KB, IP3K B, IP3KB, IP3K-B, PIG37, proliferation-inducing protein 37 |
|---|
| Gene, Accession # | ITPKB, Gene ID: 3707 |
|---|
| Catalog # | NBP1-81589 |
|---|
| Price | |
|---|
| Order / More Info | ITPKB Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 26642205 |
|---|
| 产品资料 |
|
|