| Edit |   |
|---|
| Antigenic Specificity | DGAT2L7 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The DGAT2L7 Antibody from Novus Biologicals is a rabbit polyclonal antibody to DGAT2L7. This antibody reacts with human. The DGAT2L7 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptide directed towards the C terminal of human DGAT2L7. Peptide sequence FLGRRGLPLPFRAPIRTVVGSAIPVQQSPPPSPAQVDTLQARYVGRLTQL. |
|---|
| Other Names | diacylglycerol O-acyltransferase 2 like protein 7, putative diacylglycerol O-acyltransferase 2-like protein 7 |
|---|
| Gene, Accession # | DGAT2L7P, Gene ID: 646409, Accession: CAD91637, SwissProt: CAD91637 |
|---|
| Catalog # | NBP1-91329-20ul |
|---|
| Price | |
|---|
| Order / More Info | DGAT2L7 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|