| Edit |   |
| Antigenic Specificity | DGAT2L7 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The DGAT2L7 Antibody from Novus Biologicals is a rabbit polyclonal antibody to DGAT2L7. This antibody reacts with human. The DGAT2L7 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptide directed towards the C terminal of human DGAT2L7. Peptide sequence FLGRRGLPLPFRAPIRTVVGSAIPVQQSPPPSPAQVDTLQARYVGRLTQL. |
| Other Names | diacylglycerol O-acyltransferase 2 like protein 7, putative diacylglycerol O-acyltransferase 2-like protein 7 |
| Gene, Accession # | DGAT2L7P, Gene ID: 646409, Accession: CAD91637, SwissProt: CAD91637 |
| Catalog # | NBP1-91329 |
| Price | |
| Order / More Info | DGAT2L7 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |