| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | HSD11B1L |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The HSD11B1L Antibody from Novus Biologicals is a rabbit polyclonal antibody to HSD11B1L. This antibody reacts with human. The HSD11B1L Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human HSD11B1L antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: DYLVLNHIGGAPAGTRARSPQATRWLMQVNFVSYVQLTSRALPSLTDSKGSLVVVSSLLGRVPTSFSTPYS |
|---|
| Other Names | 11-beta-hydroxysteroid dehydrogenase type 3, 11-DH3, EC 1.1.1, EC 1.1.1.-, HSD3,11-beta-HSD3, hydroxysteroid (11-beta) dehydrogenase 1-like, hydroxysteroid 11-beta-dehydrogenase 1-like protein, SCDR10short chain dehydrogenase/reductase 10, SDR26C2, short chain dehydrogenase/reductase family 26C, member 2, Short-chain dehydrogenase/reductase 10 |
|---|
| Gene, Accession # | HSD11B1L, Gene ID: 374875 |
|---|
| Catalog # | NBP2-55319 |
|---|
| Price | |
|---|
| Order / More Info | HSD11B1L Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|