| Edit |   |
|---|
| Antigenic Specificity | Leucine Rich Repeat and Fibronectin Type III Domain Containing 3 (LRFN3) (C-Term) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | LRFN3 belongs to the LRFN family. Its exact function remains unknown. |
|---|
| Immunogen | LRFN3 antibody was raised using the C terminal of LRFN3 corresponding to a region with amino acids VYRMIPAESRSFLLTDLASGRTYDLCVLAVYEDSATGLTATRPVGCARFS |
|---|
| Other Names | FIGLER1|SALM4|A530045B06Rik|Salm4|LRFN3 |
|---|
| Gene, Accession # | Gene ID: 79414,233067,308495 |
|---|
| Catalog # | ABIN635732 |
|---|
| Price | |
|---|
| Order / More Info | Leucine Rich Repeat and Fibronectin Type III Domain Containing 3 (LRFN3) (C-Term) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|