| Edit |   |
|---|
| Antigenic Specificity | Leucine Rich Repeat and Fibronectin Type III Domain Containing 5 (LRFN5) (Middle Region) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The specific function of LRFN5 is not yet known. |
|---|
| Immunogen | LRFN5 antibody was raised using the middle region of LRFN5 corresponding to a region with amino acids PLITRHTHEMRVLEGQRATLRCKARGDPEPAIHWISPEGKLISNATRSLV |
|---|
| Other Names | C14orf146|FIGLER8|SALM5|AI427653|AI604817|C130061B21|mKIAA4208 |
|---|
| Gene, Accession # | Gene ID: 145581,238205,314164 |
|---|
| Catalog # | ABIN636112 |
|---|
| Price | |
|---|
| Order / More Info | Leucine Rich Repeat and Fibronectin Type III Domain Containing 5 (LRFN5) (Middle Region) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|