| Edit |   |
|---|
| Antigenic Specificity | Leucine Rich Repeat and Ig Domain Containing 4 (LINGO4) (Middle Region) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The function of LINGO4 protein has not been widely studied, and is yet to be fully elucidated. |
|---|
| Immunogen | LINGO4 antibody was raised using the middle region of LINGO4 corresponding to a region with amino acids TLEIRSVQLRDRGAYVCVVSNVAGNDSLRTWLEVIQVEPPNGTLSDPNIT |
|---|
| Other Names | DAAT9248|LRRN6D|PRO34002|A530050P17Rik|LERN4|Lrrn6d|RGD1562025 |
|---|
| Gene, Accession # | Gene ID: 339398,320747,499668 |
|---|
| Catalog # | ABIN635071 |
|---|
| Price | |
|---|
| Order / More Info | Leucine Rich Repeat and Ig Domain Containing 4 (LINGO4) (Middle Region) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|