| Edit |   |
|---|
| Antigenic Specificity | Leucine Rich Repeat Containing 8 Family, Member A (LRRC8A) (Middle Region) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | LRRC8A is a protein belonging to the leucine-rich repeat family of proteins, which are involved in diverse biological processes, including cell adhesion, cellular trafficking, and hormone-receptor interactions. |
|---|
| Immunogen | LRRC8 A antibody was raised using the middle region of LRRC8 corresponding to a region with amino acids NLTQIELRGNRLECLPVELGECPLLKRSGLVVEEDLFNTLPPEVKERLWR |
|---|
| Other Names | wu:fb18g12|wu:fi21b10|LRRC8|AGM5|LLRC8A|Lrrc8|mKIAA1437 |
|---|
| Gene, Accession # | Gene ID: 56262 |
|---|
| Catalog # | ABIN635022 |
|---|
| Price | |
|---|
| Order / More Info | Leucine Rich Repeat Containing 8 Family, Member A (LRRC8A) (Middle Region) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|