| Edit |   |
|---|
| Antigenic Specificity | alpha-N-Acetylgalactosaminide alpha-2,6-Sialyltransferase 3 (SIA7C) (C-Term) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | ST6GALNAC3 belongs to a family of sialyltransferases that transfer sialic acids from CMP-sialic acid to terminal positions of carbohydrate groups in glycoproteins and glycolipids. |
|---|
| Immunogen | ST6 GALNAC3 antibody was raised using the C terminal of ST6 ALNAC3 corresponding to a region with amino acids HYYEQGRDECDEYFLHEHAPYGGHRFITEKKVFAKWAKKHRIIFTHPNWT |
|---|
| Other Names | fb68h09|siat7c|st6GalNAc-III|wu:fb67c12|wu:fb68h09|zgc:73301|SIAT7C|PRO7177|ST6GALNACIII|STY|Siat7c |
|---|
| Gene, Accession # | Gene ID: 256435,20447,29758 |
|---|
| Catalog # | ABIN635748 |
|---|
| Price | |
|---|
| Order / More Info | alpha-N-Acetylgalactosaminide alpha-2,6-Sialyltransferase 3 (SIA7C) (C-Term) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|