| Edit |   |
|---|
| Antigenic Specificity | Acrosomal Vesicle Protein 1 (ACRV1) (N-Term) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | ACRV1 is a testis-specific, differentiation antigen, acrosomal vesicle protein 1, that arises within the acrosomal vesicle during spermatogenesis, and is associated with the acrosomal membranes and matrix of mature sperm. The acrosomal vesicle protein 1 may be involved in sperm-zona binding or penetration, and it is a potential contraceptive vaccine immunogen for humans. |
|---|
| Immunogen | ACRV1 antibody was raised using the N terminal of ACRV1 corresponding to a region with amino acids MNRFLLLMSLYLLGSARGTSSQPNELSGSIDHQTSVQQLPGEFFSLENPS |
|---|
| Other Names | ACRV1|D11S4365|SP-10|SPACA2|Msa63|Sp10 |
|---|
| Gene, Accession # | Gene ID: 56 |
|---|
| Catalog # | ABIN633880 |
|---|
| Price | |
|---|
| Order / More Info | Acrosomal Vesicle Protein 1 (ACRV1) (N-Term) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|