| Edit |   |
| Antigenic Specificity | Alkaline Phosphatase, Placental (ALP) |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | purified |
| Size | 100 µg |
| Concentration | n/a |
| Applications | Western Blotting (WB),Immunohistochemistry (IHC) |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | There are at least four distinct but related alkaline phosphatases: intestinal, placental, placental-like, and liver/bone/kidney (tissue non-specific). The first three are located together on chromosome 2 while the tissue non-specific form is located on chromosome 1. ALPP is a membrane bound glycosylated enzyme, also referred to as the heat stable form, that is expressed primarily in the placenta although it is closely related to the intestinal form of the enzyme as well as to the placental-like form. |
| Immunogen | ALPP antibody was raised using a synthetic peptide corresponding to a region with amino acids TVLLYGNGPGYVLKDGARPDVTESESGSPEYRQQSAVPLDEETHAGEDVA |
| Other Names | Akp2|alp|zgc:56672|ALP|DDBDRAFT_0205491|DDBDRAFT_0231570|DDB_0205491|DDB_0231570|ECK0378|JW0374|psiA|PALP|PLAP|PLAP-1|ALPI|ALP1|CRASH|2410004D18Rik|AU040643|AW060375|Actn2lp|Alp |
| Gene, Accession # | Gene ID: 250 |
| Catalog # | ABIN630143 |
| Price | |
| Order / More Info | Alkaline Phosphatase, Placental (ALP) Antibody from ANTIBODIES-ONLINE GmbH |
| Product Specific References | n/a |