| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | ATF6 beta |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ATF6 beta Antibody from Novus Biologicals is a rabbit polyclonal antibody to ATF6 beta. This antibody reacts with human, mouse. The ATF6 beta Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human, mouse, rat ATF6 beta antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: KPVVLTTVPMPSRAVPPSTTVLLQSLVQPPPVSPVVLIQGAIRVQPEGPAPSLPRPERKSIVPAPMPGNSCPPEVDAKLLKRQQR |
|---|
| Other Names | activating transcription factor 6 betacAMP-dependent transcription factor ATF-6 beta, ATF6-beta, cAMP response element-binding protein-related protein, cAMP responsive element binding protein-like 1, CREBL1CREB-RP, Creb-related protein, Creb-rp, cyclic AMP-dependent transcription factor ATF-6 beta, FLJ10066, G13cAMP-responsive element-binding protein-like 1, Protein G13 |
|---|
| Gene, Accession # | ATF6B, Gene ID: 1388 |
|---|
| Catalog # | NBP1-91687 |
|---|
| Price | |
|---|
| Order / More Info | ATF6 beta Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 29186574 |
|---|
| 产品资料 |
|
|