| 产品详情 |
| Edit |   |
| Antigenic Specificity | MCRS1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse, rat |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The MCRS1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to MCRS1. This antibody reacts with human, mouse, rat. The MCRS1 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human, mouse, rat MCRS1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: HPDAFYLARTAKALQAHWQLMKQYYLLEDQTVQPLPKGDQVLNFSDAEDLIDDSKLKDMRDEVLEHELMVADRRQKREIRQLEQELHKWQVLVD |
| Other Names | Cell cycle-regulated factor p78, ICP22BP, INO80 complex subunit Q, INO80Q58 kDa microspherule protein, MCRS2INO80 complex subunit J, microspherule protein 1, MSP58cell cycle-regulated factor (78 kDa), P78 |
| Gene, Accession # | MCRS1, Gene ID: 10445, Accession: Q96EZ8, SwissProt: Q96EZ8 |
| Catalog # | NBP1-81615 |
| Price | |
| Order / More Info | MCRS1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|