| Edit |   |
|---|
| Antigenic Specificity | SCEL |
|---|
| Clone | 4B12 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG2b kappa |
|---|
| Format | Protein A purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA. This antibody is reactive against recombinant protein in WB and ELISA. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The SCEL Antibody (4B12) from Novus Biologicals is a mouse monoclonal antibody to SCEL. This antibody reacts with human. The SCEL Antibody (4B12) has been validated for the following applications: Western Blot, ELISA. |
|---|
| Immunogen | SCEL (NP_003834.2, 2 a.a. - 97 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SNVTLRKMSPTGNEMKSTTQGTTRKQQDFHEVNKRRTFLQDNSWIKKRPEEEKDENYGRVVLNRHNSHDALDRKVNERDVPKATISRYSSDDTLDR |
|---|
| Other Names | FLJ21667, MGC22531, sciellin |
|---|
| Gene, Accession # | SCEL, Gene ID: 8796, Accession: NP_003834, SwissProt: NP_003834 |
|---|
| Catalog # | H00008796-M01 |
|---|
| Price | |
|---|
| Order / More Info | SCEL Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|