| 产品详情 |
| Edit |   |
| Antigenic Specificity | GLS2 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse, rat |
| Isotype | n/a |
| Format | Alexa Fluor 532 conjugate |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Optimal dilution of this antibody should be experimentally determined. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The GLS2 Antibody [Alexa Fluor® 532] from Novus Biologicals is a rabbit polyclonal antibody to GLS2. This antibody reacts with human, mouse, rat. The GLS2 Antibody [Alexa Fluor® 532] has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. |
| Immunogen | Synthetic peptides corresponding to GLS2(glutaminase 2 (liver, mitochondrial)) The peptide sequence was selected from the middle region of GLS2. Peptide sequence FVGKEPSGLRYNKLSLNEEGIPHNPMVNAGAIVVSSLIKMDCNKAEKFDF. |
| Other Names | EC 3.5.1.2, GAbreast cell glutaminase, GLSglutaminase GA, glutaminase 2 (liver, mitochondrial), glutaminase I, glutaminase liver isoform, mitochondrial, hLGA, LGA, L-glutaminase, L-glutamine amidohydrolase, MGC71567, phosphate-activated glutaminase, phosphate-dependent glutaminase, truncated glutaminase 2 |
| Gene, Accession # | GLS2, Gene ID: 27165 |
| Catalog # | NBP1-54773AF532 |
| Price | |
| Order / More Info | GLS2 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|