| Edit |   |
|---|
| Antigenic Specificity | Chromodomain Protein, Y-Linked, 1 (CDY1) (C-Term) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | purified |
|---|
| Size | 100 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | CDY1 containing a chromodomain and a histone acetyltransferase catalytic domain. Chromodomain proteins are components of heterochromatin-like complexes and can act as gene repressors. Histone hyperacetylation is thought to facilitate the transition in which protamines replace histones as the major DNA-packaging protein. |
|---|
| Immunogen | CDY1 antibody was raised using the C terminal of CDY1 corresponding to a region with amino acids FPRTWWQSAEDVHREKIQLDLEAEFYFTHLIVMFKSPRPAAMVLDRSQDF |
|---|
| Other Names | CDY|CDY1A|CDY2A|CDY1|CDY2|CDY1B|CDY2B |
|---|
| Gene, Accession # | Gene ID: 9085 |
|---|
| Catalog # | ABIN629620 |
|---|
| Price | |
|---|
| Order / More Info | Chromodomain Protein, Y-Linked, 1 (CDY1) (C-Term) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|