| Edit |   |
|---|
| Antigenic Specificity | Stromal Antigen 3 (STAG3) (Middle Region) |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 50 µg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blotting (WB) |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | STAG3 is a meiosis specific component of cohesin complex. The cohesin complex is required for the cohesion of sister chromatids after DNA replication. The cohesin complex apparently forms a large proteinaceous ring within which sister chromatids can be trapped. At anaphase, the complex is cleaved and dissociates from chromatin, allowing sister chromatids to segregate. The meiosis-specific cohesin complex probably replaces mitosis specific cohesin complex when it dissociates from chromatin during prophase I. |
|---|
| Immunogen | STAG3 antibody was raised using the middle region of STAG3 corresponding to a region with amino acids VPHQVILPALTLVYFSILWTLTHISKSDASQKQLSSLRDRMVAFCELCQS |
|---|
| Other Names | STAG3|SA-2 |
|---|
| Gene, Accession # | Gene ID: 10734 |
|---|
| Catalog # | ABIN634086 |
|---|
| Price | |
|---|
| Order / More Info | Stromal Antigen 3 (STAG3) (Middle Region) Antibody from ANTIBODIES-ONLINE GmbH |
|---|
| Product Specific References | n/a |
|---|