| 产品详情 |
| Edit |   |
| Antigenic Specificity | HSD17B4 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse, rat |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The HSD17B4 Antibody from Novus Biologicals is a rabbit polyclonal antibody to HSD17B4. This antibody reacts with human, mouse, rat. The HSD17B4 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human, mouse, rat HSD17B4 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: ESCEENGGLFEVGAGWIGKLRWERTLGAIVRQKNHPMTPEAVKANWKKICDFENASKPQSIQESTGSIIEVLSK |
| Other Names | 12-alpha-trihydroxy-5-beta-cholest-24-enoyl-CoA hydratase, 7-alpha, D-bifunctional protein, EDH17B4, hydroxysteroid (17-beta) dehydrogenase 4, MPF-2, peroxisomal, peroxisomal multifunctional enzyme type 2,17-beta-HSD IV, peroxisomal multifunctional protein 2,17beta-estradiol dehydrogenase type IV, short chain dehydrogenase/reductase family 8C, member 1,3-alpha |
| Gene, Accession # | HSD17B4, Gene ID: 3295 |
| Catalog # | NBP1-85296 |
| Price | |
| Order / More Info | HSD17B4 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | PubMed: 28185952, 28958038 |
| 产品资料 |
|
|