| Edit |   |
|---|
| Antigenic Specificity | ATAD1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ATAD1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ATAD1. This antibody reacts with human. The ATAD1 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptide directed towards the C terminal of human ATAD1The immunogen for this antibody is ATAD1. Peptide sequence KQREAILKLILKNENVDRHVDLLEVAQETDGFSGSDLKEMCRDAALLCVR. |
|---|
| Other Names | AFDC1, ATPase family AAA domain-containing protein 1, ATPase family, AAA domain containing 1, FLJ14600 |
|---|
| Gene, Accession # | ATAD1, Gene ID: 84896, Accession: NP_116199, SwissProt: NP_116199 |
|---|
| Catalog # | NBP1-79861-20ul |
|---|
| Price | |
|---|
| Order / More Info | ATAD1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|