| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Laminin alpha 5 |
|---|
| Clone | CL3118 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG1 |
|---|
| Format | Protein A purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin, Knockdown Validated. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Laminin alpha 5 Antibody (CL3118) from Novus Biologicals is a mouse monoclonal antibody to Laminin alpha 5. This antibody reacts with human. The Laminin alpha 5 Antibody (CL3118) has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin, Knockdown Validated. Specificity of human Laminin alpha 5 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: LNLSSIILDVNQDRLTQRAIEASNAYSRILQAVQAAEDAAGQALQQADHTWATVVRQGLVDRAQQLLANSTALEEAMLQEQQRLGLVWAAL |
|---|
| Other Names | KIAA0533, KIAA1907, laminin alpha-5 chain, laminin subunit alpha-5, laminin, alpha 5, Laminin-10 subunit alpha, Laminin-11 subunit alpha, Laminin-15 subunit alpha |
|---|
| Gene, Accession # | LAMA5, Gene ID: 3911, Accession: O15230, SwissProt: O15230 |
|---|
| Catalog # | NBP2-42391 |
|---|
| Price | |
|---|
| Order / More Info | Laminin alpha 5 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|